| Transcript | Ll_transcript_423032 |
|---|---|
| CDS coordinates | 813-1112 (+) |
| Peptide sequence | MAELYLSRKLVVSSSPTSNSDSPNWQCNSPNLASKIHTSSTTTVHMENDVEELEMLLEAYFLQIDGTLNKLATLREYTDDTEDYINIQLDNHRNQLIQV* |
| ORF Type | complete |
| Blastp | Magnesium transporter MRS2-2 from Arabidopsis with 70.97% of identity |
|---|---|
| Blastx | Magnesium transporter MRS2-2 from Arabidopsis with 70.97% of identity |
| Eggnog | Magnesium transporter(ENOG410XNNZ) |
| Kegg | Link to kegg annotations (AT5G64560) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019444478.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer