Protein coding transcript 48262

• Transcript: Ll_transcript_423031
• CDS coordinates: 169-774 (+)
• Peptide sequence: MEEELHASSINNKTCALRSWIMIDHHGIETILDVDKYAIMRLLQIHARDLRILDPLLSYPSTIFGREKAIILNLEHIKAIITAKQVFLRDPKDDHVVPIVEELRRRLPEVNCSGQGEEDKSTQEGEGGEGNDFPFEFRALEVALEAICSFLDARTRELETASYPALDELTSKISSRNLDRVRKLKSSMTRLTNRVQKLACR*
• ORF Type: complete

Annotations of Ll_transcript_423031

• Blastp: Magnesium transporter MRS2-2 from Arabidopsis with 70.97% of identity
• Blastx: Magnesium transporter MRS2-I from Oryza sativa with 68.82% of identity
• Eggnog: Magnesium transporter(ENOG410XNNZ)
• Kegg: Link to kegg annotations (AT5G64560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444478.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;