Transcript | Ll_transcript_373626 |
---|---|
CDS coordinates | 176-1150 (+) |
Peptide sequence | MKSMVSPVTRVSLFCGLNIHKASFSPLTFFNSYSLPFTPTLSLSMAASSQSTPSTVSPGDVNINKDDVFQLIQAHQEKAARLPPVEEIRTVLDRSVRGMLSTFSKAHEGYPSGSLVDFAFDADGYPILAVSDLAVHAKDLTANPKCSLLVARDPEDRTDLVITLHGDAISVSEKDKEAVRAAYLARHPNAFWVDFGDFHFLRIEPKVVRFVSGVATALLGSGEFTGDEFKAAKVDPIAQFSKPVASHMNNDHAEDTKVIVQHWTSVPVDFANILDLDSLGFNVKAGYQGSTFKLRVPFPRRAADRKDVKTLIVEMLHAATPKVN* |
ORF Type | complete |
Blastp | Glutamyl-tRNA reductase-binding protein, chloroplastic from Arabidopsis with 23.75% of identity |
---|---|
Blastx | Glutamyl-tRNA reductase-binding protein, chloroplastic from Arabidopsis with 23.75% of identity |
Eggnog | NA(ENOG410XX7U) |
Kegg | Link to kegg annotations (AT3G21200) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019457130.1) |
Pfam | Pyridoxamine 5'-phosphate oxidase (PF01243.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer