| Transcript | Ll_transcript_422759 |
|---|---|
| CDS coordinates | 1-306 (+) |
| Peptide sequence | MKLAYLLWKQVQKILQMWNRHSWPCLLLSRIEWQANHRQITAGLQQCKSKDNQLGRKVGVALPNQMIVSISISLGLMHADSCKICYFTKQWRPMSHNLFSV* |
| ORF Type | complete |
| Blastp | - |
|---|---|
| Blastx | Ras-related protein RABD2a from Arabidopsis with 87.5% of identity |
| Eggnog | member RAS oncogene family(ENOG410XQN5) |
| Kegg | Link to kegg annotations (AT1G02130) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019463953.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer