Protein coding transcript 48318

• Transcript: Ll_transcript_423785
• CDS coordinates: 3557-4003 (+)
• Peptide sequence: MYNDDYAYLQSRLSSESKKNLVFPGSYATKIWLVGEQFNEAEQKKAPKGSMFIPFTQFPPKKLRKDCFYHTTPAMITPLSLVNVHSCEDWLPRRVMSAWRVAGILHALEGWNVNECGDNMFSIHKVWEASLQHGFRPLKINHVASILN*
• ORF Type: complete

Annotations of Ll_transcript_423785

• Blastp: Protein ECERIFERUM 1 from Arabidopsis with 56.94% of identity
• Blastx: Protein ECERIFERUM 1 from Arabidopsis with 70.78% of identity
• Eggnog: WAX2-like(ENOG4111G66)
• Kegg: Link to kegg annotations (AT1G02205)
• CantataDB: Link to cantataDB annotations (CNT0002405)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019465410.1)
• Pfam: WAX2 C-terminal domain (PF12076.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;