Protein coding transcript 48320

• Transcript: Ll_transcript_423787
• CDS coordinates: 1892-2554 (+)
• Peptide sequence: MPIYDYIYGTIDKNTDTTYEISLKKEEDSIHVVHLTHLTTPESVYHLRLGFASFASRPLLLSSKFYHYFMWPFTLWSVLITWFYAQTFVVERNSFKNFNLQSWVIPRFHVQYLFKWQRETLNKYIEEAILQAEMSKVKVLSLGLLNQGEKLNKNGELYIKNYPQLKIKIVDGSSLVVAIVLNSIPKETSEVLLCSKLTKVSFAIVNALCERGTKVIYVLF*
• ORF Type: complete

Annotations of Ll_transcript_423787

• Blastp: Protein ECERIFERUM 1 from Arabidopsis with 57.67% of identity
• Blastx: Protein ECERIFERUM 1 from Arabidopsis with 70.78% of identity
• Eggnog: WAX2-like(ENOG4111G66)
• Kegg: Link to kegg annotations (AT1G02205)
• CantataDB: Link to cantataDB annotations (CNT0002405)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019465410.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;