Protein coding transcript 48350

• Transcript: Ll_transcript_424139
• CDS coordinates: 868-1389 (+)
• Peptide sequence: MYRVMPVANGLLDWSCRTYVMGVLNLTPDSFSDGGNFQSVKSAVSQVQLLISEGADIIDLGAQSTRPMASRISVEEELDRLIPVLEAVTAMPEVEGKLISVDTFYSEVASEAVSRGAHFINDVSAGQLDPNMFKVIADLDVPYIAMHMRGDPSTMQTNENLEYDDVFKEVSSEL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_424139

• Blastp: Folate synthesis bifunctional protein, mitochondrial from Pisum with 83.33% of identity
• Blastx: Folate synthesis bifunctional protein, mitochondrial from Pisum with 83.76% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020983881.1)
• Pfam: Pterin binding enzyme (PF00809.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;