Transcript | Ll_transcript_422333 |
---|---|
CDS coordinates | 2-361 (+) |
Peptide sequence | STLPLRIRYLQKFHFLLPIPMALSKLLVASILASLLLLHLVDAAQSVHSQMHGSLLQQIDCNGACTARCRLSSRPRLCQRACGTCCRRCNCVPPGTAGNQKLCPCYASLTTHGGTRKCP* |
ORF Type | 5prime_partial |
Blastp | Snakin-2 from Solanum with 63.46% of identity |
---|---|
Blastx | Snakin-2 from Solanum with 79.69% of identity |
Eggnog | gast1 protein homolog 1(ENOG410YWQ9) |
Kegg | Link to kegg annotations (102582131) |
CantataDB | Link to cantataDB annotations (CNT0001808) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433680.1) |
Pfam | Gibberellin regulated protein (PF02704.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer