Protein coding transcript 48386

• Transcript: Ll_transcript_422079
• CDS coordinates: 312-992 (+)
• Peptide sequence: MMNGTQYSGESSSSTSRNSQQDIEDDGMIALVLSEEYAKLDGAVGRRLTNLAPVPHVPRINSFIPNMSDASMDHQRLLQRLNIYGLCEVKVSGDGNCQFRALSDQLFRSSEHHKYVRKEIGKQIKDHRSLYECYVPMKYKRYYKKMAKSGEWGDHVTLQAAADKFAAKICLLTSFRDTCFIEIMPLYQAPKRELWLSFWSEVHYNSLYEIRDAPIQHKPRRKHWLF*
• ORF Type: complete

Annotations of Ll_transcript_422079

• Blastp: OTU domain-containing protein DDB_G0284757 from Dictyostelium with 36.48% of identity
• Blastx: OTU domain-containing protein DDB_G0284757 from Dictyostelium with 36.48% of identity
• Eggnog: OTU-like cysteine protease(ENOG4111GFM)
• Kegg: Link to kegg annotations (DDB_G0284757)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430191.1)
• Pfam: OTU-like cysteine protease (PF02338.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;