Transcript | Ll_transcript_422072 |
---|---|
CDS coordinates | 897-1577 (+) |
Peptide sequence | MMNGTQYSGESSSSTSRNSQQDIEDDGMIALVLSEEYAKLDGAVGRRLTNLAPVPHVPRINSFIPNMSDASMDHQRLLQRLNIYGLCEVKVSGDGNCQFRALSDQLFRSSEHHKYVRKEIGKQIKDHRSLYECYVPMKYKRYYKKMAKSGEWGDHVTLQAAADKFAAKICLLTSFRDTCFIEIMPLYQAPKRELWLSFWSEVHYNSLYEIRDAPIQHKPRRKHWLF* |
ORF Type | complete |
Blastp | OTU domain-containing protein DDB_G0284757 from Dictyostelium with 36.48% of identity |
---|---|
Blastx | OTU domain-containing protein DDB_G0284757 from Dictyostelium with 36.48% of identity |
Eggnog | OTU-like cysteine protease(ENOG4111GFM) |
Kegg | Link to kegg annotations (DDB_G0284757) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430191.1) |
Pfam | OTU-like cysteine protease (PF02338.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer