Protein coding transcript 48448

• Transcript: Ll_transcript_423808
• CDS coordinates: 580-1014 (+)
• Peptide sequence: MTGIVDYTNYDDMRYAIRKLDDSEFRNAFSRSYIRVREYDRRSYSRSPSRDSRGSYSRSPSRSPYMSRSRSRSPYMSRSRSRSHSHSYSDRSRSLSPKAKRSQRSVSLSSILRIKVDDHGSVSKILGMWKDGGGIEKADNWVGH*
• ORF Type: complete

Annotations of Ll_transcript_423808

• Blastp: Serine/arginine-rich splicing factor SR30 from Arabidopsis with 77.08% of identity
• Blastx: Serine/arginine-rich splicing factor SR30 from Arabidopsis with 78.05% of identity
• Eggnog: Rna-binding protein(COG0724)
• Kegg: Link to kegg annotations (AT1G09140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422957.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;