Protein coding transcript 48451

• Transcript: Ll_transcript_423836
• CDS coordinates: 1-516 (+)
• Peptide sequence: LKPVLLVVVFVFHFPAHLSWIHGDCHHYISTVVLLQYSLHSLQIRKLDDSEFRNAFSRSYIRVREYDRRSYSRSPSRDSRGSYSRSPSRSPYMSRSRSRSPYMSRSRSRSHSHSYSDRSRSLSPKAKRSQRSVSLSSILRIKVDDHGSVSKILGMWKDGGGIEKADNWVGH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_423836

• Blastp: Serine/arginine-rich-splicing factor SR34 from Arabidopsis with 46.55% of identity
• Blastx: Serine/arginine-rich-splicing factor SR34 from Arabidopsis with 44% of identity
• Eggnog: Rna-binding protein(COG0724)
• Kegg: Link to kegg annotations (AT1G02840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422957.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;