Protein coding transcript 48460

• Transcript: Ll_transcript_421865
• CDS coordinates: 1614-1979 (+)
• Peptide sequence: MKVWIKKMFGENPKNSNTIARIVNKQHFLRLKNLLTDPEVKKSVVYGGSMDEDNLFIEPTILVDPPLDAAIMADEIFGPLLPIITVEKIEDSIKFIRSRPKPLALYVFTKNQTLQRRMISET
• ORF Type: 3prime_partial

Annotations of Ll_transcript_421865

• Blastp: Aldehyde dehydrogenase family 3 member F1 from Arabidopsis with 59.02% of identity
• Blastx: Aldehyde dehydrogenase family 3 member F1 from Arabidopsis with 57.06% of identity
• Eggnog: Dehydrogenase(COG1012)
• Kegg: Link to kegg annotations (AT4G36250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448596.1)
• Pfam: Aldehyde dehydrogenase family (PF00171.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;