Transcript | Ll_transcript_423641 |
---|---|
CDS coordinates | 113-520 (+) |
Peptide sequence | MELTWLSFILVGAFGYFIGSHYPSRFLLSSLRSLPKDNNFNNKNNSKSKFKDPLPIEQLAQILDDFKMILVVRNDLKMGKGKIAAQCSHATLGLYKKLHNRAPKALHRWEMCAQPKVVVKIESEEDMLALQVSIV* |
ORF Type | complete |
Blastp | Peptidyl-tRNA hydrolase 2, mitochondrial from Homo with 50% of identity |
---|---|
Blastx | Peptidyl-tRNA hydrolase 2, mitochondrial from Homo with 61.04% of identity |
Eggnog | The natural substrate for this enzyme may be peptidyl- tRNAs which drop off the ribosome during protein synthesis (By similarity)(COG1990) |
Kegg | Link to kegg annotations (51651) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413692.1) |
Pfam | Peptidyl-tRNA hydrolase PTH2 (PF01981.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer