Transcript | Ll_transcript_424371 |
---|---|
CDS coordinates | 165-518 (+) |
Peptide sequence | MMQVLMGAIDFYSSSSFSMVKSNTNLQQLGFKHRPTTFSFDGNQRKNFVVMASTIPVEQVNKVPLQVKGDSFIREHLRKLAPYQPILPFEVLSSRLGRKPEDIVKLDANENPYGPPPE |
ORF Type | 3prime_partial |
Blastp | Histidinol-phosphate aminotransferase, chloroplastic from Nicotiana with 54.87% of identity |
---|---|
Blastx | Histidinol-phosphate aminotransferase, chloroplastic from Nicotiana with 60.82% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413939.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer