Protein coding transcript 4857

• Transcript: Ll_transcript_373690
• CDS coordinates: 158-1171 (+)
• Peptide sequence: MWTPTPETLASTKTALSVAASLAATAVLLRSTVNDLIPDTVYNYFNSNFRKFSNRLSSHLTIIIEEHDGLTANQMFDTANVYVGSKQQSSAQRIKVHKPLKEEHLQVNIDKNQEFYDSYKGIKLKWVLVSMQNNNINLHNKRDSHNNASFHRVEVRHFELTFHKKHRDTVLGSYLHHVLHEAEAIREGKKTLKLHTIDYNGTDYWNSIVLNHPATFDTVAMEPEMKVQLLEDLCKFLDRKEYYKRVGKSWKRGYLLYGPPGTGKSSLIAAMANHLKFDIYDMDLREVQCNSDLRRLLIGTGSRSILVIEDIDCSVKLHNREVNNNGEDEDKVTHPYI*
• ORF Type: complete

Annotations of Ll_transcript_373690

• Blastp: Protein HYPER-SENSITIVITY-RELATED 4 from Arabidopsis with 48.49% of identity
• Blastx: Protein HYPER-SENSITIVITY-RELATED 4 from Arabidopsis with 46.56% of identity
• Eggnog: Acts as a processive, ATP-dependent zinc metallopeptidase for both cytoplasmic and membrane proteins. Plays a role in the quality control of integral membrane proteins (By similarity)(COG0465)
• Kegg: Link to kegg annotations (AT3G50930)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457304.1)
• Pfam: Domain associated at C-terminal with AAA (PF14363.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;