Protein coding transcript 48583

• Transcript: Ll_transcript_422104
• CDS coordinates: 430-969 (+)
• Peptide sequence: MVDANSKSGGYIVYSTCSIMVAENEAVIDYALKKRDVKLVPCGLDFGRPGFTKFREQRFHPTLEKTRRFYPHVHNMDGFFVAKLKKMSSSSKPSATSEPLEKEEEGIELVKEEKASNGRKENGKDSPESKSKKEKKKNFAPKQSNDIKENGEESSESKSKKDKKRKFPPKPSNDIKENGK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_422104

• Blastp: Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase from Homo with 70.53% of identity
• Blastx: Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase from Homo with 71.94% of identity
• Eggnog: nOP2 Sun(COG0144)
• Kegg: Link to kegg annotations (4839)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426277.1)
• Pfam: 16S rRNA methyltransferase RsmB/F (PF01189.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;