| Transcript | Ll_transcript_421962 |
|---|---|
| CDS coordinates | 230-550 (+) |
| Peptide sequence | MSLSPTSSIGLLLQQPLTMEQDGVVSKPIAVIASISMALLYVAVLYAPTLLLRLPPPSSFTNYMIRRFLCAVVSSIISLLISALILPVQTKELFGVYGIRVDHILL* |
| ORF Type | complete |
| Blastp | CAAX prenyl protease 2 from Arabidopsis with 48.89% of identity |
|---|---|
| Blastx | CAAX prenyl protease 2 from Arabidopsis with 49.44% of identity |
| Eggnog | RCE1 homolog, prenyl protein protease (S. cerevisiae)(ENOG410YPVA) |
| Kegg | Link to kegg annotations (AT2G36305) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019431497.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer