Protein coding transcript 48635

• Transcript: Ll_transcript_423759
• CDS coordinates: 168-857 (+)
• Peptide sequence: MGRFIPAFALPIILLTASILNWSLISLVELLAFLFIQYTAPRRGSRFNQQSLISWLVLMLSSLTLLAHAIFHIVLAIEGDQWSTVDAQWAQLIGLVRVQSWRTLPIEYFLVMQVLSTFLSLVEIYGNRFGPDAWRYFRTGHFCPSLLMIGSHFRGLCCFLLPAIQLIAGISHASWISLPFFIFSSIGLVVWSWTSKYLSMFRQASPSQRKQMIRLYFIVLVKLESNLLTH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_423759

• Blastp: Piezo-type mechanosensitive ion channel homolog from Arabidopsis with 41.58% of identity
• Blastx: Piezo-type mechanosensitive ion channel homolog from Arabidopsis with 41.58% of identity
• Eggnog: Piezo-type mechanosensitive ion channel component(ENOG410YVF6)
• Kegg: Link to kegg annotations (AT2G48060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423178.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;