Protein coding transcript 48688

• Transcript: Ll_transcript_423544
• CDS coordinates: 141-764 (+)
• Peptide sequence: MQTIPNPVYLFQGIVLRRGAKGTGMKSIELALSMCDIVDMYGFTVDPGYTEWTRYFSAPRKGHNPLQGRAYYQLLECLGVIRIHSPMRSGRRQDWSDVPSREMISQAHAAALRLKKSQAASDIGQFGNCKVWGNVEPGKSGPVSGSSDMSDIRKLSNYSKWEVMPFKSLRKEAQDHYMQMQGVTLYKMDGNKLDDLVCVRHSLKSEV*
• ORF Type: complete

Annotations of Ll_transcript_423544

• Blastp: Sialyltransferase-like protein 1 from Arabidopsis with 80.86% of identity
• Blastx: Sialyltransferase-like protein 1 from Arabidopsis with 78.8% of identity
• Eggnog: ST3 beta-galactoside alpha-2,3-sialyltransferase(ENOG410XT8P)
• Kegg: Link to kegg annotations (AT1G08660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447502.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;