Protein coding transcript 48689

• Transcript: Ll_transcript_423546
• CDS coordinates: 536-1624 (+)
• Peptide sequence: MCETLLLWEQYRNMTTVLTREYLDVRPDGWVHYAPLRIAQLGTKKCHNKTLCEEQLNILLPAKPPFRPRQFRTCAVVGNSGDLLKTEFGKEIDSHDAVFRDNEAPVNEKYAKYVGLKRDFRLVVRGAARNMVPILNGSDNEVLIIKSVTHREINAVIKTIPNPVYLFQGIVLRRGAKGTGMKSIELALSMCDIVDMYGFTVDPGYTEWTRYFSDPRKGHNPLQGRAYYQLLECLGVIRIHSPMRSARRQDWSDVPSREMISQAHAAAFRLKKSQASDIGQFGNCKVWGHVNPDKSGPISGTSDMSDVRKFSNYSKWEVMPFKSLRKEAQNHYMQMQGVSLYKMDGNKLDDLVCVRHSLKSEV*
• ORF Type: complete

Annotations of Ll_transcript_423546

• Blastp: Sialyltransferase-like protein 1 from Arabidopsis with 81.92% of identity
• Blastx: Sialyltransferase-like protein 1 from Arabidopsis with 81.71% of identity
• Eggnog: ST3 beta-galactoside alpha-2,3-sialyltransferase(ENOG410XT8P)
• Kegg: Link to kegg annotations (AT1G08660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457242.1)
• Pfam: Glycosyltransferase family 29 (sialyltransferase) (PF00777.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;