Protein coding transcript 487

• Transcript: Ll_transcript_336269
• CDS coordinates: 1-315 (+)
• Peptide sequence: SLHPPRPPNLTPLALPITHTPAKMVHTNGAAAQGETFLFTSESVGQGHPDKIADQVSDAVLDACLKEDPLSKVACECATKTGMVMIFGEITTKTKVDYQKVVREA
• ORF Type: internal

Annotations of Ll_transcript_336269

• Blastp: S-adenosylmethionine synthase from Neurospora with 82.28% of identity
• Blastx: S-adenosylmethionine synthase from Neurospora with 82.28% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (NCU02657)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_007163224.1)
• Pfam: S-adenosylmethionine synthetase, N-terminal domain (PF00438.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;