Transcript | Ll_transcript_373601 |
---|---|
CDS coordinates | 103-1008 (+) |
Peptide sequence | MGGLLHLQRFPLSIFLRSHSPKFPTRTTLFFSPKSTLTTPEPLTDNDSPSDSETPHVQLSLDKLFIPPDTRVPVDSGSARILKGSNIVLSNYARDSNVVQADYVKSSVRTEDCPSDGLPEFALVGRSNVGKSSLLNSIVRRKKLALTSKKPGKTQCINHFKINDNWYLVDLPGYGYASAPQELRMNWDNFTKDYFLNRSTLVSVFLLIDASIPAKQIDLDYASWLGQNQIPMTIIFTKCDKRKKRKNGGRRPEENVNDFQDLIRGFFETVPPWIMTSSVTNQGRDEILLHMAQLRNYWLKH* |
ORF Type | complete |
Blastp | GTP-binding protein At2g22870 from Arabidopsis with 57.87% of identity |
---|---|
Blastx | GTP-binding protein At2g22870 from Arabidopsis with 57.02% of identity |
Eggnog | Necessary for normal cell division and for the maintenance of normal septation (By similarity)(COG0218) |
Kegg | Link to kegg annotations (AT2G22870) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417758.1) |
Pfam | 50S ribosome-binding GTPase (PF01926.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer