Transcript | Ll_transcript_422611 |
---|---|
CDS coordinates | 581-1630 (+) |
Peptide sequence | MISNSSSFDCLGLEVVGKNNDNLVKDRVGNADSDNVRQRNLFCQLLKVYREVNSSGGIVRPVSVLLGDGQVLDLYKLFSLVKERGGYAAVSRKGSWGFVTKGLGLDLEVLASVKLAYDKYLNDFEAWLKKTFEEKIIRNRNHGYGWSFKPFPLEMEKELSVLLCLDLKEKDDELDIKEKDDELDIKEDNTKLELKSKKIRRFIDLLVNHKNETKLLDTNNQNNICEDVQNVHVDGDEKLCSGDKYDLAILDKEDVEKEYNNRKRKRESLTGMLNWMKHIAKHPLVPVTPPLPKPSKWKEYKGEDFFSLLLRARKVLLLKHCVEPNGGPASLQFLTKLLAVMKKNFKEQH* |
ORF Type | complete |
Blastp | AT-rich interactive domain-containing protein 2 from Arabidopsis with 45.05% of identity |
---|---|
Blastx | AT-rich interactive domain-containing protein 2 from Arabidopsis with 45.05% of identity |
Eggnog | NA(ENOG410YHCT) |
Kegg | Link to kegg annotations (AT4G11400) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424146.1) |
Pfam | ARID/BRIGHT DNA binding domain (PF01388.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer