Protein coding transcript 48825

• Transcript: Ll_transcript_422618
• CDS coordinates: 581-1582 (+)
• Peptide sequence: MISNSSSFDCLGLEVVGKNNDNLVKDRVGNADSDNVRQRNLFCQLLKVYREVNSSGGIVRPVSVLLGDGQVLDLYKLFSLVKERGGYAAVSRKGSWGFVTKGLGLDLEVLASVKLAYDKYLNDFEAWLKKTFEEKIIRNRNHGYGWSFKPFPLEMEKELSVLLCLDLKEKDDELDIKEKDDELDIKEDNTKLELKSKKIRRFIDLLVNHKNETKLLDTNNQNNICEDVQNVHVDGDEKLCSGDKYDLAILDKEDVEKEYNNRKRKRESLTGMLNWMKHIAKHPLVPVTPPLPKPSKWKEYKGEDFFSLLLRARKVLLLKHCVEPNGGPASLQV*
• ORF Type: complete

Annotations of Ll_transcript_422618

• Blastp: AT-rich interactive domain-containing protein 2 from Arabidopsis with 45.05% of identity
• Blastx: AT-rich interactive domain-containing protein 2 from Arabidopsis with 45.05% of identity
• Eggnog: NA(ENOG410YHCT)
• Kegg: Link to kegg annotations (AT4G11400)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424146.1)
• Pfam: ARID/BRIGHT DNA binding domain (PF01388.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;