Transcript | Ll_transcript_424569 |
---|---|
CDS coordinates | 40-597 (+) |
Peptide sequence | MAIGESSQQQADGQNVVSQGASEKAANPMRELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGIRRNEKISVHVTVRGAKAEEILERGLKVKEYELRKRNFSESGNFGFGISEHIDLGIKYDPIIGIYGMDFYVCMTRPGERVAKRRRCQSKIGSSHKVNQQETVKWYKNR |
ORF Type | 3prime_partial |
Blastp | 60S ribosomal protein L11 from Neurospora with 85.98% of identity |
---|---|
Blastx | 60S ribosomal protein L11 from Neurospora with 85.98% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (NCU02509) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453483.1) |
Pfam | Ribosomal protein L5 (PF00281.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer