Protein coding transcript 48871

• Transcript: Ll_transcript_424580
• CDS coordinates: 46-519 (+)
• Peptide sequence: MRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGIRRNEKISVHVTVRGAKAEEILERGLKVKEYELRKRNFSESGNFGFGISEHIDLGIKYDPIIGIYGMDFYVCMTRPGERVAKRRRCQSKIGSSHKVNQQETVKWYKNR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_424580

• Blastp: 60S ribosomal protein L11 from Neurospora with 84.52% of identity
• Blastx: 60S ribosomal protein L11 from Neurospora with 84.52% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (NCU02509)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453483.1)
• Pfam: Ribosomal protein L5 (PF00281.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;