Protein coding transcript 489

• Transcript: Ll_transcript_357365
• CDS coordinates: 2-493 (+)
• Peptide sequence: FKTVNSVFFDPSSETNTATPESWFTTSSESPSFSTESEDYCHYDGESLDMLVRGVRSERLFFEPGDTSSILEKAKAIGFPFKESVVLAMESEDPYEDFKRSMEEMVESHDVKDWDGLEELLGWYLRVNGKNNHGFIVGAFVDLLISMAASNSSSDSTTYSSAVS
• ORF Type: internal

Annotations of Ll_transcript_357365

• Blastp: Transcription repressor OFP13 from Arabidopsis with 54.55% of identity
• Blastx: Transcription repressor OFP13 from Arabidopsis with 50.59% of identity
• Eggnog: atofp18 ofp18(ENOG410YHQG)
• Kegg: Link to kegg annotations (AT5G04820)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451451.1)
• Pfam: Transcriptional repressor, ovate (PF04844.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;