Protein coding transcript 48900

• Transcript: Ll_transcript_422236
• CDS coordinates: 80-1021 (+)
• Peptide sequence: MSGMGDGYVGTSQDAVRIRRLEKQREAERRKIQELKTKSVSEKGQPGLLQFGSSTSEILETAFKKETVGLVTREEYVEKRVNIKTKIEEEEKEKLQKQQQEEEEFQLQKRKKRKIKGNSRLSFAEDIENDGEEEEGQDTENLETNRLRHGKLGKDPTVETSFLPDSEREAEEEAERERLRKQWLREQEQIRNEPLQITYSYWDGTGHRRVIQVRKGDSIGEFLRAVQQQLAPEFREIRTTSVENMLYVKEDLIIPHQHSFYELIVNKARGKSGPVSSFPFTSLYFKISSLLDGASLSGFLKLIIDDCSILFLL*
• ORF Type: complete

Annotations of Ll_transcript_422236

• Blastp: Protein XAP5 CIRCADIAN TIMEKEEPER from Arabidopsis with 81.36% of identity
• Blastx: Protein XAP5 CIRCADIAN TIMEKEEPER from Arabidopsis with 77.06% of identity
• Eggnog: Family with sequence similarity 50, member(ENOG410XNXM)
• Kegg: Link to kegg annotations (AT2G21150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414267.1)
• Pfam: XAP5, circadian clock regulator (PF04921.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;