Protein coding transcript 49040

• Transcript: Ll_transcript_326297
• CDS coordinates: 3-1034 (+)
• Peptide sequence: RFFPKDPCCSINVHLAYVPLCLLITNWALSVYNFVFVPLFSFQAIGQVLFLRPYVNDFSTEWALSSIILLTLGSVFTTYIGERITDLKLGNGTSLLIFTNIISYLPASFGRVFAQALKDANYIGLVTIILSFILLVVGIVYVQEAERKIPLNYASRFTSKSRGLEKSAYLPFKVNSSGVMPIIFSTSSLALPGTLARFTGVSALKNAALALNPGGSFYLPFNILLIAFFNYYYTFLQLDPDDLSEQLKRQGASIPLVRPGRSTSTFIKTVLSRISVLGSTFLAILAAGPSVVEQTTHLTAFRGFAGTSILILVGCATDTARKVQAEIISQKYKNIEFYDVDKY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_326297

• Blastp: Preprotein translocase subunit SECY, chloroplastic from Pisum with 90.37% of identity
• Blastx: Preprotein translocase subunit SECY, chloroplastic from Pisum with 90.37% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415337.1)
• Pfam: SecY translocase (PF00344.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;