Protein coding transcript 49043

• Transcript: Ll_transcript_326302
• CDS coordinates: 2-793 (+)
• Peptide sequence: ALRLKYSVLLPQSNLVLWIIMLITITEASSSPLCFFLNRFNTKPSKTLRNFPICQASFSVQRRPNTTHSWNQPHLSTTSYDVANFDPLDINSDLSSALSSTWENLVSLFSQTFESASNTEKERPNTARGAAAAIEDSSIDFGDFFKGPLPGKFLKLLGFLALSRLGVYIPLGGVNREAFVGNLDQNSLLSTLDSFSGGGIGRLGICSLGIVPFINAQIVFQLLAQIYPKLQDLQKKEGEAGRKKVLQYTRYASVGFAIVQVSN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_326302

• Blastp: Preprotein translocase subunit SCY1, chloroplastic from Arabidopsis with 76.33% of identity
• Blastx: Preprotein translocase subunit SCY1, chloroplastic from Arabidopsis with 76.33% of identity
• Eggnog: The central subunit of the protein translocation channel SecYEG. Consists of two halves formed by TMs 1-5 and 6-10. These two domains form a lateral gate at the front which open onto the bilayer between TMs 2 and 7, and are clamped together by SecE at the back. The channel is closed by both a pore ring composed of hydrophobic SecY resides and a short helix (helix 2A) on the extracellular side of the membrane which forms a plug. The plug probably moves laterally to allow the channel to open. The ring and the pore may move independently (By similarity)(COG0201)
• Kegg: Link to kegg annotations (AT2G18710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415337.1)
• Pfam: SecY translocase (PF00344.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;