Transcript | Ll_transcript_326291 |
---|---|
CDS coordinates | 127-456 (+) |
Peptide sequence | MASFRAFLNSPVGPKTTHFWGPVANWGFVAAGLADMQKPPEMISGNMTGAMCVYSALFMRFAWMVQPRNYLLLVCHVSNEGVQLYQLSRWAKAQGYLSEKKEEASSSSQ* |
ORF Type | complete |
Blastp | Mitochondrial pyruvate carrier 1 from Arabidopsis with 86.54% of identity |
---|---|
Blastx | Mitochondrial pyruvate carrier 1 from Arabidopsis with 87.5% of identity |
Eggnog | Brain protein 44-like(ENOG4111TU9) |
Kegg | Link to kegg annotations (AT5G20090) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019451598.1) |
Pfam | Uncharacterised protein family (UPF0041) (PF03650.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer