Transcript | Ll_transcript_326353 |
---|---|
CDS coordinates | 2-1069 (+) |
Peptide sequence | WNFRKNMALVTTPTVNDGPLFAEVNMSSDFNAPTVRATVVQASTIFYDTPATLDKAERLLAEAASYGAQIVVFPEAFIGGYPRGSNFGVSIGNRTAKGKEDFRKYHSAAVDVPGPEVDRLAAMAGKYKVYLVMGVIERDGYTLYCTVLFFDSQGHYLGKHRKLMPTALERIIWGFGDGSTIPVFETPIGKIGAAICWENKMPLLRTAMYAKGVEIYCAPTADSREVWQASMTHIALEGGCFVLSANQFCRRRDYPPPPEYVFEGTEENLTPDSVVCAGGSVIISPSGAVLAGPSYEGEALISADLDLGEIARAKFDFDVVGHYSRPEVLSLVVKDHPTNPVTFTSASTKIEDKTK* |
ORF Type | 5prime_partial |
Blastp | Bifunctional nitrilase/nitrile hydratase NIT4A from Lupinus with 98.48% of identity |
---|---|
Blastx | Bifunctional nitrilase/nitrile hydratase NIT4A from Lupinus with 98.57% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (109351736) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448859.1) |
Pfam | Carbon-nitrogen hydrolase (PF00795.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer