Protein coding transcript 49222

• Transcript: Ll_transcript_326428
• CDS coordinates: 302-976 (+)
• Peptide sequence: MMGTVGIPMTTIEARLESVPEMEYDALSSEARGEICLRGITLFSGYHKRQDLTEEVMVDGWFHTGDIGEWQPNGAMKIIDRKKNIFKLSQGEYIAVESIENKYLQCPLITSIWVYGNSFESFLVAVVVPERKALEDWALEHNLTNDFEHLCDNLKARKYIMDELNSIGLKHQLRGFELLKAVHLEPIPFDIERDLITPTFKLKRPQMLKYYKDHIDQLYKEAKV*
• ORF Type: complete

Annotations of Ll_transcript_326428

• Blastp: Long chain acyl-CoA synthetase 2 from Arabidopsis with 73.78% of identity
• Blastx: Long chain acyl-CoA synthetase 2 from Arabidopsis with 71.99% of identity
• Eggnog: Amp-dependent synthetase and ligase(COG1022)
• Kegg: Link to kegg annotations (AT1G49430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420557.1)
• Pfam: AMP-binding enzyme (PF00501.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;