Transcript | Ll_transcript_326728 |
---|---|
CDS coordinates | 1-660 (+) |
Peptide sequence | ANFDELIAAAAAAAANRDPLEVAKQIELHFQRASDSGSQVAKILEVGKLPYHPKHTGPYQASSKILHAVAPSLSLVSSQPSTSKSAESTELAATATLDFDFDLTMRSRNLSSTLQKLYLWEKKLYNEVKAEEKMRVLHDRKCRKLKRMDERGADFHKVESTRALIRSLSTKIRMAIQVVDRISMTINKIRDEELWPQLKELIQGYVKLRTSGLVIYAGS* |
ORF Type | 5prime_partial |
Blastp | Nitrate regulatory gene2 protein from Arabidopsis with 31.68% of identity |
---|---|
Blastx | Nitrate regulatory gene2 protein from Arabidopsis with 32.12% of identity |
Eggnog | Protein of unknown function (DUF632)(ENOG410YACB) |
Kegg | Link to kegg annotations (AT3G60320) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019435788.1) |
Pfam | Protein of unknown function (DUF632) (PF04782.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer