Protein coding transcript 49272

• Transcript: Ll_transcript_327584
• CDS coordinates: 192-803 (+)
• Peptide sequence: MFIFSILLLGSAIGFRLDSLLKLTETRARNNKMTLMHYLCKVLADQLPEVLDFSKDLSNLEPAAKIQIKFLAEEMQAVSKGLEKVVQELSTSENDGPISETFRKNLKGFLSSAEAEVRSLASLYSGVGRNVDMLILYFGEDPYRCTFEQVVTTLLNFTRMFNKAHEENCKQLELEMKKTEESGKKKCESERRLPTTVSTGNVE*
• ORF Type: complete

Annotations of Ll_transcript_327584

• Blastp: Formin-like protein 13 from Arabidopsis with 78.7% of identity
• Blastx: Formin-like protein 13 from Arabidopsis with 78.7% of identity
• Eggnog: actin cytoskeleton organization(ENOG410XT5Z)
• Kegg: Link to kegg annotations (AT5G58160)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441423.1)
• Pfam: Formin Homology 2 Domain (PF02181.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;