Protein coding transcript 49317

• Transcript: Ll_transcript_327894
• CDS coordinates: 347-829 (+)
• Peptide sequence: MFQFPIAFVVFGNEAVKLYKDHKRRLSTGNIECICEASIEWTPLHITFCALCGILGGTVGGLLGSGGGFVLGPLLLEIGVIPQVASATATFVMMFSSSLSVVEFYLLKRFPIPYALYLTGVSILAGFFGQYLVRKLIAILKRASVIVFILSAVIFASALTM
• ORF Type: 3prime_partial

Annotations of Ll_transcript_327894

• Blastp: Sulfite exporter TauE/SafE family protein 4 from Arabidopsis with 79.25% of identity
• Blastx: Sulfite exporter TauE/SafE family protein 4 from Arabidopsis with 78.4% of identity
• Eggnog: Sulfite exporter TauE/SafE(ENOG410Y9P7)
• Kegg: Link to kegg annotations (AT2G36630)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444293.1)
• Pfam: Sulfite exporter TauE/SafE (PF01925.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;