Protein coding transcript 49328

• Transcript: Ll_transcript_327875
• CDS coordinates: 24-851 (+)
• Peptide sequence: MSIFSTNGFILYLLSGFSLAILFSLFLTHSNQPKYSSLNSLHASTTHKVWPELELSWKLVLATVIGFLGSAFGTVGGVGGGGIFVPMLTLIIGFDTKSAAALSKCMIMGASASSVWYNLRVPHPTKEVPILDYDLALLFQPMLMLGITVGVALSVVFPYWLITVLIIILFIGTSSRSLFRGTEMWKEETIMKKEMAKQQQTFVNSRGELLIDTEYEPLIPKEKKTAMQILCFNLRWKRILMLMIVWVSFLLLQIIKNNVKVCSAWYWVLYTLQVW*
• ORF Type: complete

Annotations of Ll_transcript_327875

• Blastp: Sulfite exporter TauE/SafE family protein 4 from Arabidopsis with 71.27% of identity
• Blastx: Sulfite exporter TauE/SafE family protein 4 from Arabidopsis with 71% of identity
• Eggnog: Sulfite exporter TauE/SafE(ENOG410Y9P7)
• Kegg: Link to kegg annotations (AT2G36630)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456852.1)
• Pfam: Sulfite exporter TauE/SafE (PF01925.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;