Protein coding transcript 49378

• Transcript: Ll_transcript_327281
• CDS coordinates: 2-556 (+)
• Peptide sequence: EEVVPQIAGMGEFQGTILHTSSYKSGSMFCGKNVLVVGCGNSGMEVCLDLCNHNARPTLVVRDTVHILPQQMLGKSTFGLSMCLLKCFPIRFVDQILLIMSHLMLGDTSQFGLNRPKLGPLELKNLNGKTPVLDVGTLAQIRSGKIKVCRGIKRLTQHTVEFVDGKVKNFDAIILATGYKSNVPS
• ORF Type: internal

Annotations of Ll_transcript_327281

• Blastp: Indole-3-pyruvate monooxygenase YUCCA6 from Arabidopsis with 68.45% of identity
• Blastx: Indole-3-pyruvate monooxygenase YUCCA6 from Arabidopsis with 68.45% of identity
• Eggnog: Monooxygenase(COG2072)
• Kegg: Link to kegg annotations (AT5G25620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436640.1)
• Pfam: L-lysine 6-monooxygenase (NADPH-requiring) (PF13434.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;