Transcript | Ll_transcript_328394 |
---|---|
CDS coordinates | 320-1840 (+) |
Peptide sequence | MSYSRFLVYLNKDRVRKVDLFDNGTIAVVEAVSLDNRVQRLRVQLPGLSRELLEKFREKNVDFAAHNAQEESGSLLFNQIGNLAFPLILIGGLFLLSRRSPGGMGGPGRPGSPLAFGQSKAKFQMVPSTGVTFDDVAGVEEAKQDFMEVVEFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENSPCIVFVDEIDAVGRQRGTGIGGGNDEREQTLNQLLTEMDGFEGNTGVIVIAATNRADILDSALLRPGRFDRQVTVDVPDIRGRTEILKVHGSNKKFDADVSLEVIAMRTPGFSGADLANLLNEAAILAGRRGKTAISSKEIDDSIDRIVAGMEGMVMTDGKSKSLVAYHEVGHAICGTLTPGHDAVQKVTLVPRGQARGLTWFIPSDDPTLISKQQLFARIVGGLGGRAAEEIIFGEPEVTTGAAGDLQQITGLAKQMVTTFGMSDIGPWSLMDTSAQSGD |
ORF Type | 3prime_partial |
Blastp | ATP-dependent zinc metalloprotease FTSH 2, chloroplastic from Arabidopsis with 89.74% of identity |
---|---|
Blastx | ATP-dependent zinc metalloprotease FTSH 2, chloroplastic from Oryza sativa with 87.88% of identity |
Eggnog | Acts as a processive, ATP-dependent zinc metallopeptidase for both cytoplasmic and membrane proteins. Plays a role in the quality control of integral membrane proteins (By similarity)(COG0465) |
Kegg | Link to kegg annotations (AT2G30950) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418270.1) |
Pfam | TIP49 C-terminus (PF06068.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer