Protein coding transcript 49429

• Transcript: Ll_transcript_328394
• CDS coordinates: 320-1840 (+)
• Peptide sequence: MSYSRFLVYLNKDRVRKVDLFDNGTIAVVEAVSLDNRVQRLRVQLPGLSRELLEKFREKNVDFAAHNAQEESGSLLFNQIGNLAFPLILIGGLFLLSRRSPGGMGGPGRPGSPLAFGQSKAKFQMVPSTGVTFDDVAGVEEAKQDFMEVVEFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENSPCIVFVDEIDAVGRQRGTGIGGGNDEREQTLNQLLTEMDGFEGNTGVIVIAATNRADILDSALLRPGRFDRQVTVDVPDIRGRTEILKVHGSNKKFDADVSLEVIAMRTPGFSGADLANLLNEAAILAGRRGKTAISSKEIDDSIDRIVAGMEGMVMTDGKSKSLVAYHEVGHAICGTLTPGHDAVQKVTLVPRGQARGLTWFIPSDDPTLISKQQLFARIVGGLGGRAAEEIIFGEPEVTTGAAGDLQQITGLAKQMVTTFGMSDIGPWSLMDTSAQSGD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_328394

• Blastp: ATP-dependent zinc metalloprotease FTSH 2, chloroplastic from Arabidopsis with 89.74% of identity
• Blastx: ATP-dependent zinc metalloprotease FTSH 2, chloroplastic from Oryza sativa with 87.88% of identity
• Eggnog: Acts as a processive, ATP-dependent zinc metallopeptidase for both cytoplasmic and membrane proteins. Plays a role in the quality control of integral membrane proteins (By similarity)(COG0465)
• Kegg: Link to kegg annotations (AT2G30950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418270.1)
• Pfam: TIP49 C-terminus (PF06068.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;