Protein coding transcript 49440

• Transcript: Ll_transcript_327133
• CDS coordinates: 488-1411 (+)
• Peptide sequence: MMMFFNLKTSEVDSALQKMRHMEASLSKAHRAFPDCTAMATKLRAMNHNAEEQVRTQRYQTSYLVHLAARTTPKGFHCLSMRLTTDYFSLRPEERKFPNENKIHDPKLHHYAVFSDNILACAVVVNSTVFTAKEPEKLVLHVLTNPLNFPAISMWFLLNPPGKATIHIQNIDNIKWLPKDNTFKKLNSSDPRYTSELNYLRFYLPDIFPTLNKIVLFDHDVVVQRDLSRLWDVNMNGKVIAAVGTCKEGETPFHRMDMFINFSDPFNAKRFDVNACTWAFGMNLFDLQKWRRHNLTAVYHKYLQMVC*
• ORF Type: complete

Annotations of Ll_transcript_327133

• Blastp: Probable galacturonosyltransferase 6 from Arabidopsis with 60.54% of identity
• Blastx: Probable galacturonosyltransferase 6 from Arabidopsis with 60.54% of identity
• Eggnog: Galacturonosyltransferase(ENOG410YA0P)
• Kegg: Link to kegg annotations (AT1G06780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456475.1)
• Pfam: Glycosyl transferase family 8 (PF01501.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;