Protein coding transcript 49491

• Transcript: Ll_transcript_327021
• CDS coordinates: 164-1279 (+)
• Peptide sequence: MGSSSDTRLLQELLLYAASAALSCLVLFTGLRHLDPNREASKKALEHKKEIAKRLGRPLIQTNPYEDVIACDVINPDDIDVEFNSIGGLEKIKQALFELVILPLKRPDLFSNGKLLGPQRGVLLYGPPGTGKTMLAKAIAKESEAVFINVRISNLMSKWFGDAQKLVAAVFSLAHKLQPAIIFIDEVDSFLGQRRTTDHEALLNMKTEFMALWDGFTTDQNARVMVLAATNRPSELDEAILRRLPQAFEIGVPDQRERAEILKVILNGERVEDNIDFVHVAGLCQGYTGSDLFDLCKKAAYFPIRELLDEEKKGKRSSVSIFVFLVSCFSRYNFFISCGLAVEDNMLSTDDITKFIYISASSFLTREQIIF*
• ORF Type: complete

Annotations of Ll_transcript_327021

• Blastp: ATPase family AAA domain-containing protein 1-A from Danio with 46.59% of identity
• Blastx: ATPase family AAA domain-containing protein 1-A from Danio with 46.59% of identity
• Eggnog: Aaa atpase(COG0464)
• Kegg: Link to kegg annotations (368672)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417688.1)
• Pfam: Parvovirus non-structural protein NS1 (PF01057.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;