Protein coding transcript 49503

• Transcript: Ll_transcript_327456
• CDS coordinates: 505-831 (+)
• Peptide sequence: MEGMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRYNFLPCYLNY*
• ORF Type: complete

Annotations of Ll_transcript_327456

• Blastp: V-type proton ATPase 16 kDa proteolipid subunit from Gossypium with 98.97% of identity
• Blastx: V-type proton ATPase subunit c4 from Arabidopsis with 98.97% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107898580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020978713.1)
• Pfam: ATP synthase subunit C (PF00137.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;