Transcript | Ll_transcript_327468 |
---|---|
CDS coordinates | 124-531 (+) |
Peptide sequence | MAPFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILI |
ORF Type | 3prime_partial |
Blastp | V-type proton ATPase 16 kDa proteolipid subunit from Vigna with 99.26% of identity |
---|---|
Blastx | V-type proton ATPase 16 kDa proteolipid subunit from Vigna with 99.26% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (106780537) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_006592081.1) |
Pfam | ATP synthase subunit C (PF00137.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer