Transcript | Ll_transcript_328045 |
---|---|
CDS coordinates | 159-1016 (+) |
Peptide sequence | MVDGPQHPSVVQKLAGHSYLVSRLSPNFNSRNYSNPGACFNGGVQPCGLALVSPVSSIAVPAPAEKGAAGFLVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGISDCFARTMKDEGVIALWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDAKASKKGGERQFNGLVDVYRKTIKSDGVAGLYRGFNISCIGIIVYRGLYFGMYDSLKPVVLVGGMQVCAKFESELRLC* |
ORF Type | complete |
Blastp | ADP,ATP carrier protein 3, mitochondrial from Arabidopsis with 77.22% of identity |
---|---|
Blastx | ADP,ATP carrier protein 3, mitochondrial from Arabidopsis with 77.22% of identity |
Eggnog | transmembrane transport(ENOG410XNW0) |
Kegg | Link to kegg annotations (AT4G28390) |
CantataDB | - |
Mirbase | egu-MIR172e (MI0020571) |
Ncbi protein | Link to NCBI protein (XP_019453709.1) |
Pfam | Mitochondrial carrier protein (PF00153.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer