Protein coding transcript 49532

• Transcript: Ll_transcript_328048
• CDS coordinates: 271-729 (+)
• Peptide sequence: MVDGPQHPSVVQKLAGHSYLVSRLSPNFNSRNYSNPGACFNGGVQPCGLALVSPVSSIAVPAPAEKGAAGFLVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGISDCFARTMKDEGVIALWRGNTANVIRYFPTQVII*
• ORF Type: complete

Annotations of Ll_transcript_328048

• Blastp: ADP,ATP carrier protein 3, mitochondrial from Arabidopsis with 67.3% of identity
• Blastx: ADP,ATP carrier protein 3, mitochondrial from Arabidopsis with 68.15% of identity
• Eggnog: transmembrane transport(ENOG410XNW0)
• Kegg: Link to kegg annotations (AT4G28390)
• CantataDB: -
• Mirbase: egu-MIR172e (MI0020571)
• Ncbi protein: Link to NCBI protein (XP_019453709.1)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;