Protein coding transcript 4955

• Transcript: Ll_transcript_321807
• CDS coordinates: 1676-2191 (+)
• Peptide sequence: MRGYYKPVCGVIGGPKFSSKSVSQEAESFLLDAVNMSFFERLNLAWKIIFPSAVSRKSSNARIAKQRLKMILFSDRCAISDEAKQKIVSNVVRALSDFVEIESQDKVQLSVSADTDLGTIYSVTVPVRRVKPEYQDADESGMITNVEYKDTGVSSGSVDVTFDFFVPDEMS*
• ORF Type: complete

Annotations of Ll_transcript_321807

• Blastp: Cell division topological specificity factor homolog, chloroplastic from Arabidopsis with 71.26% of identity
• Blastx: Cell division topological specificity factor homolog, chloroplastic from Arabidopsis with 66.16% of identity
• Eggnog: Septum formation topological specificity factor MinE(ENOG41122SR)
• Kegg: Link to kegg annotations (AT1G69390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433390.1)
• Pfam: Septum formation topological specificity factor MinE (PF03776.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;