Protein coding transcript 49553

• Transcript: Ll_transcript_325858
• CDS coordinates: 1087-2118 (+)
• Peptide sequence: MQENVVQELQQMQPDEQMKHKMLDILKRFHSEEEMDSMDEDSSADSTLSEETLEKILSGEEISFDDLSLEEKKRFQRAIAYGDLSKMIKPWDPWWSKPSARKIRLSREGTQLVQPLSEQELPDDIGSNESTDIPFGPETPLPPLSTLSSKEPSPLLTVHLVDILYSYCFTLRLYNGDWRSDALGSVMVVLNVSLVLGQGGQPETVLEALSHCLEQICSPAYRHMGGLQFGLAVVHDVISLLELGSSALLCAFCDMHRLIREGEKEAKSEKRRKDEIRSTIKLAERKTYFIMCWVHEQPEEVWSSLAAIVSAEKTIMESQRSNKAEILNNKGATKGKCIIEEIQ*
• ORF Type: complete

Annotations of Ll_transcript_325858

• Blastp: Zinc finger HIT domain-containing protein 2 from Homo with 26.28% of identity
• Blastx: -
• Eggnog: zinc finger(ENOG4111VC9)
• Kegg: Link to kegg annotations (741)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434973.1)
• Pfam: SHQ1 protein (PF04925.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;