Protein coding transcript 49576

• Transcript: Ll_transcript_326985
• CDS coordinates: 64-372 (+)
• Peptide sequence: MYSYEMQWLDLMLFFLWNSGDADGRVPVIGTRYWIETLGLPLKSTWHSWYHNNQVGGRIVEYEGLTYVTVRGAGHLVPLNKPTEALSLIDSFLTGEHLPTKP*
• ORF Type: complete

Annotations of Ll_transcript_326985

• Blastp: Serine carboxypeptidase-like 33 from Arabidopsis with 72.94% of identity
• Blastx: Serine carboxypeptidase-like 33 from Arabidopsis with 56.67% of identity
• Eggnog: carboxy-peptidase(COG2939)
• Kegg: Link to kegg annotations (AT3G17180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013458324.1)
• Pfam: Serine carboxypeptidase (PF00450.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;