Protein coding transcript 49578

• Transcript: Ll_transcript_326987
• CDS coordinates: 761-1060 (+)
• Peptide sequence: MNGIFQDYSEIDIYNIYVPKCRLNSTPSMTIAHDSKSHGPESFTEVRNDYRVGRMRIFGGYDPCYSTYTEEYFNRIDTQSCLHTNNERRKTNVTWKVCK*
• ORF Type: complete

Annotations of Ll_transcript_326987

• Blastp: Serine carboxypeptidase-like 26 from Oryza sativa with 42.86% of identity
• Blastx: Serine carboxypeptidase-like 26 from Oryza sativa with 64.79% of identity
• Eggnog: carboxy-peptidase(COG2939)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463273.1)
• Pfam: Serine carboxypeptidase (PF00450.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;